Succinate dehydrogenase subunit 5-B, mitochondrial Succinate dehydrogenase assembly factor 2-B, mitochondrial 156 SDF2B_DROME MLRQFIVSTVGRRLQLPMMAQSRLASNLDKTEYTTPGEIVDYDDPPHLPVPEYPVRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRIRQPDL Required for insertion of FAD cofactor into Scs-fp, the catalytic subunit of succinate dehydrogenase (SDH). SDH is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). In is unclear whether it participates in the chemistry of FAD attachment (enzymatic function) or acts as a chaperone that maintains Scs-fp in a conformation that is susceptible to autocatalytic FAD attachment (By similarity). CG12895 CG12895